| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EEF1G |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. Recommended conditions for IHC,Retrieval method: HIER pH6 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EEF1G Antibody from Novus Biologicals is a rabbit polyclonal antibody to EEF1G. This antibody reacts with human. The EEF1G Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDI |
|---|
| Other Names | eEF-1B gamma, EF-1-gamma, EF1Gelongation factor 1-gamma, eukaryotic translation elongation factor 1 gamma, GIG35, pancreatic tumor-related protein, PRO1608, translation elongation factor eEF-1 gamma chain |
|---|
| Gene, Accession # | EEF1G, Gene ID: 1937 |
|---|
| Catalog # | NBP2-68716 |
|---|
| Price | |
|---|
| Order / More Info | EEF1G Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|