| 产品详情 |
| Edit |   |
| Antigenic Specificity | EEF1E1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The EEF1E1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EEF1E1. This antibody reacts with human, mouse, rat. The EEF1E1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat EEF1E1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDL |
| Other Names | AIMP3Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3, ARS-interacting multifunctional protein 3, Elongation factor p18, eukaryotic translation elongation factor 1 epsilon 1, eukaryotic translation elongation factor 1 epsilon-1, Multisynthase complex auxiliary component p18, P18, p18 component of aminoacyl-tRNA synthetase complex |
| Gene, Accession # | EEF1E1, Gene ID: 9521 |
| Catalog # | NBP1-89186 |
| Price | |
| Order / More Info | EEF1E1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|