| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EEF1D |
|---|
| Clone | 4B12 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EEF1D Antibody (4B12) from Novus Biologicals is a mouse monoclonal antibody to EEF1D. This antibody reacts with human. The EEF1D Antibody (4B12) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | EEF1D (NP_115754, 1 a.a. - 91 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRSGKASCTLETVWEDKHKYEEAERRFYEHEATQAAASAQQLPAEGPAMNGPGQDDPEDADEAEAPDGGSRRDPRKSQDSRKPLQKKRKRS |
|---|
| Other Names | Antigen NY-CO-4, EF-1D, EF-1-delta, EF1DFP1047, elongation factor 1-delta, eukaryotic translation elongation factor 1 delta (guanine nucleotide exchangeprotein), FLJ20897, guanine nucleotide exchange protein |
|---|
| Gene, Accession # | EEF1D, Gene ID: 1936, Accession: NP_115754, SwissProt: NP_115754 |
|---|
| Catalog # | H00001936-M04 |
|---|
| Price | |
|---|
| Order / More Info | EEF1D Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|