| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | eEF1A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The eEF1A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to eEF1A1. This antibody reacts with human. The eEF1A1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to EEF1A1(eukaryotic translation elongation factor 1 alpha 1) The peptide sequence was selected from the C terminal of EEF1A1 (NP_001393). Peptide sequence IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGK. |
|---|
| Other Names | CCS3, CCS-3, cervical cancer suppressor 3, CTCL tumor antigen, EE1A1, EEF-1, EEF1A, eEF1A-1, EF1AHNGC:16303, EF1a-like protein, EF-1-alpha-1, EF-Tu, elongation factor 1 alpha subunit, elongation factor 1-alpha 1, Elongation factor Tu, Eukaryotic elongation factor 1 A-1, eukaryotic translation elongation factor 1 alpha 1, eukaryotic translation elongation factor 1 alpha 1-like 14, FLJ25721, glucocorticoid receptor AF-1 specific elongation factor, GRAF-1EF, LENG7, leukocyte receptor cluster (LRC) member 7, Leukocyte receptor cluster member 7, MGC102687, MGC131894, MGC16224, prostate tumor-inducing protein 1, PTI1, translation elongation factor 1 alpha 1-like 14 |
|---|
| Gene, Accession # | EEF1A1, Gene ID: 1915, Accession: P68104, SwissProt: P68104 |
|---|
| Catalog # | NBP1-52880 |
|---|
| Price | |
|---|
| Order / More Info | eEF1A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|