| Edit |   |
| Antigenic Specificity | C14orf37 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The C14orf37 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C14orf37. This antibody reacts with human. The C14orf37 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C14ORF37 The peptide sequence was selected from the N terminal of C14ORF37. Peptide sequence EIAHVHAEKGQSDKMNTDDLENSSVTSKQTPQLVVSEDPMMMSAVPSATS. |
| Other Names | c14_5376, chromosome 14 open reading frame 37 |
| Gene, Accession # | C14ORF37, Gene ID: 145407 |
| Catalog # | NBP1-70435-20ul |
| Price | |
| Order / More Info | C14orf37 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |