| Edit |   |
|---|
| Antigenic Specificity | C14orf177 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C14orf177 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C14orf177. This antibody reacts with human. The C14orf177 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human C14orf177The immunogen for this antibody is C14orf177. Peptide sequence HKQGTKPMITRPSVSQLGEGKCPSSQHLQSLRHNKQHALTLTKARCCGEC. |
|---|
| Other Names | chromosome 14 open reading frame 177, FLJ25773, hypothetical protein LOC283598, putative uncharacterized protein C14orf177 |
|---|
| Gene, Accession # | C14ORF177, Gene ID: 283598, Accession: NP_872366, SwissProt: NP_872366 |
|---|
| Catalog # | NBP1-79606-20ul |
|---|
| Price | |
|---|
| Order / More Info | C14orf177 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|