| Edit |   |
|---|
| Antigenic Specificity | C14orf159 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C14orf159 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C14orf159. This antibody reacts with human. The C14orf159 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human C14orf159 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AVEQGVLKTQIPILTYQGGSVEAAQAFLCKNGDPQTPRFDHLVAIERAGRAADGNYYNARKMNIKHLVDPIDDLFLAAKKIPGISSTGVGDG |
|---|
| Other Names | C14orf160, chromosome 14 open reading frame 159, DKFZp686I02128, FLJ20950, FLJ39943, FLJ39975, hypothetical protein LOC80017 |
|---|
| Gene, Accession # | C14ORF159, Gene ID: 80017 |
|---|
| Catalog # | NBP2-55650 |
|---|
| Price | |
|---|
| Order / More Info | C14orf159 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|