| Edit |   |
| Antigenic Specificity | C12orf56 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The C12orf56 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C12orf56. This antibody reacts with human. The C12orf56 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human C12orf56 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RSLKESILRDQQESSTPSKDSTLCPRPGLKKLSLHGQGAFRPLPSPSRRSSQSAPTTGKAVSEPSCTTNTKEPQGLPDHNSIS |
| Other Names | Chromosome 12 Open Reading Frame 56, Uncharacterized Protein C12orf56 |
| Gene, Accession # | C12orf56, Gene ID: 115749, Accession: Q8IXR9, SwissProt: Q8IXR9 |
| Catalog # | NBP2-30788 |
| Price | |
| Order / More Info | C12orf56 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |