| Edit |   |
|---|
| Antigenic Specificity | C12orf50 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C12orf50 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C12orf50. This antibody reacts with human. The C12orf50 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C12ORF50 The peptide sequence was selected from the N terminal of C12ORF50. Peptide sequence INGLFLPPSSNITLQKEIQEGIPLQSQSQEPLKPQENISRPIHHPLVLKT. |
|---|
| Other Names | chromosome 12 open reading frame 50, FLJ35821, hypothetical protein LOC160419 |
|---|
| Gene, Accession # | C12ORF50, Gene ID: 160419, Accession: Q8NA57, SwissProt: Q8NA57 |
|---|
| Catalog # | NBP1-56725 |
|---|
| Price | |
|---|
| Order / More Info | C12orf50 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|