| Edit |   |
| Antigenic Specificity | C12orf49 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The C12orf49 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C12orf49. This antibody reacts with human. The C12orf49 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C12ORF49 The peptide sequence was selected from the C terminal of C12ORF49. Peptide sequence LERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKY. |
| Other Names | chromosome 12 open reading frame 49, FLJ21415, hypothetical protein LOC79794 |
| Gene, Accession # | C12ORF49, Gene ID: 79794, Accession: Q9H741, SwissProt: Q9H741 |
| Catalog # | NBP1-62508-20ul |
| Price | |
| Order / More Info | C12orf49 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |