| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LIMCH1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LIMCH1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LIMCH1. This antibody reacts with human. The LIMCH1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human LIMCH1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LHEAYKNARSQEEAEGILQQYIERFTISEAVLERLEMPKILERSHSTEPNLSSFLNDPNPMKYLRQQSLPPPKFTATVETTIARASV |
|---|
| Other Names | DKFZp434I0312, DKFZp686A01247, DKFZp686B2470, DKFZp686G18243, DKFZp686G2094, DKFZp781C1754, DKFZp781I1455, KIAA1102, LIM and calponin homology domains 1, LIM and calponin homology domains-containing protein 1, LIMCH1A, LMO7B, MGC72127 |
|---|
| Gene, Accession # | LIMCH1, Gene ID: 22998, Accession: Q9UPQ0, SwissProt: Q9UPQ0 |
|---|
| Catalog # | NBP2-39006 |
|---|
| Price | |
|---|
| Order / More Info | LIMCH1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|