| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Carbonic Anhydrase IX/CA9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Carbonic Anhydrase IX/CA9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Carbonic Anhydrase IX/CA9. This antibody reacts with human. The Carbonic Anhydrase IX/CA9 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Carbonic Anhydrase IX/CA9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a Recombinant Protein corresponding to amino acids: PCAQGVIWTVFNQTVMLSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCL |
|---|
| Other Names | CA-IX, CAIXcarbonic anhydrase 9, Carbonate dehydratase IX, carbonic anhydrase IXpMW1, carbonic dehydratase, EC 4.2.1.1, G250, Membrane antigen MN, MNRCC-associated antigen G250, P54/58N, RCC-associated protein G250, Renal cell carcinoma-associated antigen G250 |
|---|
| Gene, Accession # | CA9, Gene ID: 768 |
|---|
| Catalog # | NBP2-54743 |
|---|
| Price | |
|---|
| Order / More Info | Carbonic Anhydrase IX/CA9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|