| Edit |   |
| Antigenic Specificity | KBTBD5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KBTBD5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KBTBD5. This antibody reacts with human. The KBTBD5 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human KBTBD5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QDLIFMISEEGAVAYDPAANECYCASLSSQVPKNHVSLVTKENQVFVAGGLFYNEDNKEDPMSAYFLQFDHLDSEWL |
| Other Names | FLJ32015, kelch repeat and BTB (POZ) domain containing 5, kelch repeat and BTB domain-containing protein 5, MGC125350, Sarcosynapsin, SRYPsarcosynapsin |
| Gene, Accession # | KBTBD5, Gene ID: 131377, Accession: Q2TBA0, SwissProt: Q2TBA0 |
| Catalog # | NBP2-38664 |
| Price | |
| Order / More Info | KBTBD5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |