| 产品详情 |
| Edit |   |
| Antigenic Specificity | Alkaline Phosphatase, Intestinal |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Alkaline Phosphatase, Intestinal Antibody from Novus Biologicals is a rabbit polyclonal antibody to Alkaline Phosphatase, Intestinal. This antibody reacts with human. The Alkaline Phosphatase, Intestinal Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Alkaline Phosphatase, Intestinal antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVE |
| Other Names | alkaline phosphatase, intestinal, alkaline phosphomonoesterase, EC 3.1.3.1, glycerophosphatase, IAP, Intestinal alkaline phosphatase, intestinal-type alkaline phosphatase, Kasahara isozyme |
| Gene, Accession # | ALPI, Gene ID: 248, SwissProt: P09923 |
| Catalog # | NBP2-34057 |
| Price | |
| Order / More Info | Alkaline Phosphatase, Intestinal Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|