| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Alkaline Phosphatase/ALPP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Alkaline Phosphatase/ALPP Antibody from Novus Biologicals is a rabbit polyclonal antibody to Alkaline Phosphatase/ALPP. This antibody reacts with human. The Alkaline Phosphatase/ALPP Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to ALPP(alkaline phosphatase, placental (Regan isozyme)) The peptide sequence was selected from the C terminal of ALPP (NP_001623). Peptide sequence TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA. |
|---|
| Other Names | Alkaline phosphatase Regan isozyme, alkaline phosphatase, placental, alkaline phosphatase, placental (Regan isozyme), alkaline phosphatase, placental type, alkaline phosphomonoesterase, ALP, EC 3.1.3.1, FLJ61142, glycerophosphatase, PALP, Placental alkaline phosphatase 1, PLAP, PLAP-1, Regan isozyme |
|---|
| Gene, Accession # | ALPP, Gene ID: 250, Accession: P05187, SwissProt: P05187 |
|---|
| Catalog # | NBP1-57907 |
|---|
| Price | |
|---|
| Order / More Info | Alkaline Phosphatase/ALPP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|