| Edit |   |
| Antigenic Specificity | ZNF692 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF692 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF692. This antibody reacts with human. The ZNF692 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human ZNF692 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GLVWECSAGHTFSWGPSLSPTPSEAPKPASLPHTTRRSWCSEATSGQELADLESEHDERTQEARLPRRVGPPPETFP |
| Other Names | AICAR responsive element binding protein, AREBP, FLJ20531, Zfp692, zinc finger protein 692 |
| Gene, Accession # | ZNF692, Gene ID: 55657, Accession: Q9BU19, SwissProt: Q9BU19 |
| Catalog # | NBP2-37973 |
| Price | |
| Order / More Info | ZNF692 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 28669730 |