| Edit |   |
|---|
| Antigenic Specificity | ZNF69 |
|---|
| Clone | 1E3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. This antibody is reactive against recombinant protein in ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF69 Antibody (1E3) from Novus Biologicals is a mouse monoclonal antibody to ZNF69. This antibody reacts with human. The ZNF69 Antibody (1E3) has been validated for the following applications: ELISA. |
|---|
| Immunogen | ZNF69 (NP_068734.1, 1 a.a. - 81 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPCCSHRRCREDPGTSESQEMEEWALLDISQRKLYKEVMLETFRNLTSVGKSWKDQNIEYEYQNPRRNFRSLIEKKVNEIK |
|---|
| Other Names | Cos5, hZNF3, MGC59928, zinc finger protein 69, zinc finger protein 69 (Cos5) |
|---|
| Gene, Accession # | ZNF69, Gene ID: 7620, Accession: NP_068734, SwissProt: NP_068734 |
|---|
| Catalog # | H00007620-M08 |
|---|
| Price | |
|---|
| Order / More Info | ZNF69 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|