| Edit |   |
|---|
| Antigenic Specificity | ZNF431 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF431 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF431. This antibody reacts with human. The ZNF431 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human ZNF431. Peptide sequence TLTKHRKIHTRQKPYNCEECDNTFNQSSNLIKQNNSYWRETLQMSRMWES. |
|---|
| Other Names | DKFZp313E0830, KIAA1969, zinc finger protein 431 |
|---|
| Gene, Accession # | ZNF431, Gene ID: 170959, Accession: NP_597730, SwissProt: NP_597730 |
|---|
| Catalog # | NBP1-80392 |
|---|
| Price | |
|---|
| Order / More Info | ZNF431 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|