| 产品详情 |
| Edit |   |
| Antigenic Specificity | ZNF428 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF428 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF428. This antibody reacts with human. The ZNF428 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ZNF428 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EEEETTDDPEYDPGYKVKQRLGGGRGGPSRRAPRAAQPPAQPCQLCGRSPLGEAPPGTPPCRLCCPATAPQEAPAPEGRALGEEEEEPPRAG |
| Other Names | Suppressor of hairy wing homolog 1, suppressor of hairy wing homolog 1 (Drosophila), zinc finger protein 280, zinc finger protein 280A, Zinc finger protein 636,3'OY11.1SUHW1, ZNF636ZNF280 |
| Gene, Accession # | ZNF428, Gene ID: 126299, Accession: Q96B54, SwissProt: Q96B54 |
| Catalog # | NBP2-31922 |
| Price | |
| Order / More Info | ZNF428 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|