| Edit |   |
|---|
| Antigenic Specificity | Zfp113 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Zfp113 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Zfp113. This antibody reacts with mouse. The Zfp113 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The specific Immunogen is proprietary information. Peptide sequence PHKCDECSKSFNRTSDLIQHQRIHTGEKPYECSECGKAFSQSAHLIQHQR. |
|---|
| Other Names | KIAA4229,4732456B05Rik, mKIAA4229, zinc finger protein 113 |
|---|
| Gene, Accession # | ZFP113, Gene ID: 56314, Accession: NP_062721 |
|---|
| Catalog # | NBP1-91373 |
|---|
| Price | |
|---|
| Order / More Info | Zfp113 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|