| Edit |   |
| Antigenic Specificity | Zfp113 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Zfp113 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Zfp113. This antibody reacts with mouse. The Zfp113 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The specific Immunogen is proprietary information. Peptide sequence PHKCDECSKSFNRTSDLIQHQRIHTGEKPYECSECGKAFSQSAHLIQHQR. |
| Other Names | KIAA4229,4732456B05Rik, mKIAA4229, zinc finger protein 113 |
| Gene, Accession # | ZFP113, Gene ID: 56314, Accession: NP_062721 |
| Catalog # | NBP1-91373-20ul |
| Price | |
| Order / More Info | Zfp113 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |