| Edit |   |
| Antigenic Specificity | ZFP112 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZFP112 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZFP112. This antibody reacts with human. The ZFP112 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF228. Peptide sequence VTFKDVAVVFTEEELGLLDSVQRKLYRDVMLENFRNLLLVAHQPFKPDLI. |
| Other Names | zfp-112, zinc finger protein 112 homolog, zinc finger protein 112 homolog (mouse), Zinc finger protein 228ZNF228 |
| Gene, Accession # | ZFP112, Gene ID: 7771, Accession: NP_037512, SwissProt: NP_037512 |
| Catalog # | NBP1-80325 |
| Price | |
| Order / More Info | ZFP112 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |