| Edit |   |
|---|
| Antigenic Specificity | ZFP112 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZFP112 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZFP112. This antibody reacts with human. The ZFP112 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF228. Peptide sequence VTFKDVAVVFTEEELGLLDSVQRKLYRDVMLENFRNLLLVAHQPFKPDLI. |
|---|
| Other Names | zfp-112, zinc finger protein 112 homolog, zinc finger protein 112 homolog (mouse), Zinc finger protein 228ZNF228 |
|---|
| Gene, Accession # | ZFP112, Gene ID: 7771, Accession: NP_037512, SwissProt: NP_037512 |
|---|
| Catalog # | NBP1-80325-20ul |
|---|
| Price | |
|---|
| Order / More Info | ZFP112 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|