| Edit |   |
|---|
| Antigenic Specificity | PPAPDC1A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPAPDC1A Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPAPDC1A. This antibody reacts with human. The PPAPDC1A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PPAPDC1A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RQHYPPLANTACHKPYVSLRVPASLKKEERPTADSAPSLPLEGITEGPV |
|---|
| Other Names | DPPL2, PPAPDC1, PPAPDC1A phosphatidic acid phosphatase type 2 domain containing 1A |
|---|
| Gene, Accession # | PPAPDC1A, Gene ID: 196051 |
|---|
| Catalog # | NBP2-14545 |
|---|
| Price | |
|---|
| Order / More Info | PPAPDC1A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 28851360 |
|---|