| 产品详情 |
| Edit |   |
| Antigenic Specificity | PPAPDC3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PPAPDC3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPAPDC3. This antibody reacts with human. The PPAPDC3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PPAPDC3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GPYETSPSLLDYLTMDIYAFPAGHASRAAMVSK |
| Other Names | C9orf67, chromosome 9 open reading frame 67, EC 3.1.3, EC 3.1.3.-, FLJ14662, KIAA0515, MGC12921, NET39, phosphatidic acid phosphatase type 2 domain containing 3, Phosphatidic acid phosphatase type 2 domain-containing protein 3, probable lipid phosphate phosphatase PPAPDC3 |
| Gene, Accession # | PLPP7, Gene ID: 84814 |
| Catalog # | NBP2-56028 |
| Price | |
| Order / More Info | PPAPDC3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|