| Edit |   |
| Antigenic Specificity | IL-26/AK155 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The IL-26/AK155 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IL-26/AK155. This antibody reacts with human. The IL-26/AK155 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is IL26 - N-terminal region. Peptide sequence: LVTLSLAIAKHKQSSFTKSCYPRGTLSQAVDALYIKAAWLKATIPEDRIK |
| Other Names | AK155IL-26interleukin-26, interleukin 26, Protein AK155 |
| Gene, Accession # | IL26, Gene ID: 55801, Accession: NP_060872, SwissProt: NP_060872 |
| Catalog # | NBP1-98520 |
| Price | |
| Order / More Info | IL-26/AK155 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |