| Edit |   |
|---|
| Antigenic Specificity | alpha-1,4-N-Acetylglucosaminyltransferase (A4GNT) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | A4GNT is a protein from the glycosyltransferase 32 family. The enzyme catalyzes the transfer of N-acetylglucosamine (GlcNAc) to core 2 branched O-glycans. It forms a unique glycan, GlcNAcalpha1-->4Galbeta-->R and is largely associated with the Golgi apparatus membrane. |
|---|
| Immunogen | A4 GNT antibody was raised using the C terminal of A4 NT corresponding to a region with amino acids NISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAV |
|---|
| Other Names | A4GNT|a4gnt|MGC116495|ALPHA4GNT|alpha4GnT|AV080780|Alpha4gnt|Gm798 |
|---|
| Gene, Accession # | Gene ID: 51146 |
|---|
| Catalog # | ABIN635982 |
|---|
| Price | |
|---|
| Order / More Info | alpha-1,4-N-Acetylglucosaminyltransferase (A4GNT) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|