| Edit |   |
|---|
| Antigenic Specificity | CCDC190 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCDC190 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC190. This antibody reacts with human. The CCDC190 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C1ORF110 The peptide sequence was selected from the N terminal of C1ORF110. Peptide sequence LKVICLYHVKLLTWEQRQLQKELQRLQQAETMKKKFSSYLGNGFQKRPED. |
|---|
| Other Names | C1orf110, chromosome 1 open reading frame 110, Coiled-Coil Domain Containing 190, FLJ41579, MGC48998, RP11-331H2.2 |
|---|
| Gene, Accession # | C1ORF110, Gene ID: 339512 |
|---|
| Catalog # | NBP1-70448 |
|---|
| Price | |
|---|
| Order / More Info | CCDC190 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|