| Edit |   |
| Antigenic Specificity | CCDC190 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CCDC190 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC190. This antibody reacts with human. The CCDC190 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C1ORF110 The peptide sequence was selected from the N terminal of C1ORF110. Peptide sequence LKVICLYHVKLLTWEQRQLQKELQRLQQAETMKKKFSSYLGNGFQKRPED. |
| Other Names | C1orf110, chromosome 1 open reading frame 110, Coiled-Coil Domain Containing 190, FLJ41579, MGC48998, RP11-331H2.2 |
| Gene, Accession # | C1ORF110, Gene ID: 339512 |
| Catalog # | NBP1-70448-20ul |
| Price | |
| Order / More Info | CCDC190 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |