| Edit |   |
| Antigenic Specificity | CCDC19 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CCDC19 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC19. This antibody reacts with human. The CCDC19 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CCDC19(coiled-coil domain containing 19) The peptide sequence was selected from the N terminal of CCDC19. Peptide sequence MPLSTAGILSSSSAASNRSRNKARYRTKAVSSEVDESLFGDIKSPAQGQS. |
| Other Names | coiled-coil domain containing 19, coiled-coil domain-containing protein 19, mitochondrial, nasopharyngeal epithelium specific protein 1 (NESG1), NESG1Nasopharyngeal epithelium-specific protein 1 |
| Gene, Accession # | CCDC19, Gene ID: 25790, Accession: Q5VU18, SwissProt: Q5VU18 |
| Catalog # | NBP1-57843 |
| Price | |
| Order / More Info | CCDC19 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |