| Edit |   |
|---|
| Antigenic Specificity | CCDC19 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCDC19 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC19. This antibody reacts with human. The CCDC19 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CCDC19(coiled-coil domain containing 19) The peptide sequence was selected from the N terminal of CCDC19. Peptide sequence MPLSTAGILSSSSAASNRSRNKARYRTKAVSSEVDESLFGDIKSPAQGQS. |
|---|
| Other Names | coiled-coil domain containing 19, coiled-coil domain-containing protein 19, mitochondrial, nasopharyngeal epithelium specific protein 1 (NESG1), NESG1Nasopharyngeal epithelium-specific protein 1 |
|---|
| Gene, Accession # | CCDC19, Gene ID: 25790, Accession: Q5VU18, SwissProt: Q5VU18 |
|---|
| Catalog # | NBP1-57843-20ul |
|---|
| Price | |
|---|
| Order / More Info | CCDC19 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|