| Edit |   |
|---|
| Antigenic Specificity | CCDC184 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCDC184 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC184. This antibody reacts with human. The CCDC184 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LOC387856(similar to expressed sequence AI836003) The peptide sequence was selected from the middle region of LOC387856. Peptide sequence LQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQG. |
|---|
| Other Names | C12orf68, chromosome 12 open reading frame 68, Coiled-Coil Domain Containing 184 |
|---|
| Gene, Accession # | C12orf68, Gene ID: 387856 |
|---|
| Catalog # | NBP1-70432 |
|---|
| Price | |
|---|
| Order / More Info | CCDC184 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|