| Edit |   |
| Antigenic Specificity | CCDC184 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CCDC184 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC184. This antibody reacts with human. The CCDC184 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LOC387856(similar to expressed sequence AI836003) The peptide sequence was selected from the middle region of LOC387856. Peptide sequence LQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQG. |
| Other Names | C12orf68, chromosome 12 open reading frame 68, Coiled-Coil Domain Containing 184 |
| Gene, Accession # | C12orf68, Gene ID: 387856 |
| Catalog # | NBP1-70432-20ul |
| Price | |
| Order / More Info | CCDC184 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |