| Edit |   |
| Antigenic Specificity | CCDC172 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CCDC172 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC172. This antibody reacts with human. The CCDC172 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CCDC172 The peptide sequence was selected from the middle region of CCDC172. Peptide sequence QANMLKSEMKSMEHDSSQLNELQKQKSELIQELFTLQRKLKVFEDEENES. |
| Other Names | C10orf96, chromosome 10 open reading frame 96, hypothetical protein LOC374355, MGC35062 |
| Gene, Accession # | CCDC172, Gene ID: 374355, Accession: P0C7W6, SwissProt: P0C7W6 |
| Catalog # | NBP1-56323 |
| Price | |
| Order / More Info | CCDC172 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |