| 产品详情 |
| Edit |   |
| Antigenic Specificity | CXCL7/NAP-2 |
| Clone | polyclonal |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified, no preservative |
| Size | 0.05 mg |
| Concentration | n/a |
| Applications | Western Blot. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CXCL7/NAP-2 Antibody from Novus Biologicals is a mouse polyclonal antibody to CXCL7/NAP-2. This antibody reacts with human. The CXCL7/NAP-2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | PPBP (NP_002695.1, 1 a.a. - 128 a.a.) full-length human protein. MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD |
| Other Names | Beta-TG, connective tissue-activating peptide III, CTAP3CTAP-III, CTAPIII, CXC chemokine ligand 7, C-X-C motif chemokine 7, CXCL7b-TG1, LA-PF4, LDGFTC1, Leukocyte-derived growth factor, low-affinity platelet factor IV, Macrophage-derived growth factor, MDGFTC2, NAP-2, NAP-2-L1, neutrophil-activating peptide 2, neutrophil-activating peptide-2, PBPTHBGB, platelet basic protein, pro-platelet basic protein (chemokine (C-X-C motif) ligand 7), SCAR10, SCYB7beta-thromboglobulin, small inducible cytokine B7, small inducible cytokine subfamily B, member 7, Small-inducible cytokine B7, TGB, TGB1B-TG1, THBGB1, thrombocidin 1, thrombocidin 2, thromboglobulin, beta-1 |
| Gene, Accession # | PPBP, Gene ID: 5473, Accession: NP_002695.1, SwissProt: NP_002695.1 |
| Catalog # | H00005473-B01P |
| Price | |
| Order / More Info | CXCL7/NAP-2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|