| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CXCL7/NAP-2 |
|---|
| Clone | 3B9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Frozen, RNA Inhibition. Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA. IHC-Fr usage reported in scientific literature (PMID: 25858640). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CXCL7/NAP-2 Antibody (3B9) from Novus Biologicals is a mouse monoclonal antibody to CXCL7/NAP-2. This antibody reacts with human. The CXCL7/NAP-2 Antibody (3B9) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Frozen, RNA Inhibition. |
|---|
| Immunogen | PPBP (AAH28217, 37 a.a. - 128 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD |
|---|
| Other Names | Beta-TG, connective tissue-activating peptide III, CTAP3CTAP-III, CTAPIII, CXC chemokine ligand 7, C-X-C motif chemokine 7, CXCL7b-TG1, LA-PF4, LDGFTC1, Leukocyte-derived growth factor, low-affinity platelet factor IV, Macrophage-derived growth factor, MDGFTC2, NAP-2, NAP-2-L1, neutrophil-activating peptide 2, neutrophil-activating peptide-2, PBPTHBGB, platelet basic protein, pro-platelet basic protein (chemokine (C-X-C motif) ligand 7), SCAR10, SCYB7beta-thromboglobulin, small inducible cytokine B7, small inducible cytokine subfamily B, member 7, Small-inducible cytokine B7, TGB, TGB1B-TG1, THBGB1, thrombocidin 1, thrombocidin 2, thromboglobulin, beta-1 |
|---|
| Gene, Accession # | PPBP, Gene ID: 5473, Accession: AAH28217, SwissProt: AAH28217 |
|---|
| Catalog # | H00005473-M01 |
|---|
| Price | |
|---|
| Order / More Info | CXCL7/NAP-2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25858640 |
|---|
| 产品资料 |
|
|