| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CXCL7/NAP-2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CXCL7/NAP-2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CXCL7/NAP-2. This antibody reacts with human. The CXCL7/NAP-2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CXCL7/NAP-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD |
|---|
| Other Names | Beta-TG, connective tissue-activating peptide III, CTAP3CTAP-III, CTAPIII, CXC chemokine ligand 7, C-X-C motif chemokine 7, CXCL7b-TG1, LA-PF4, LDGFTC1, Leukocyte-derived growth factor, low-affinity platelet factor IV, Macrophage-derived growth factor, MDGFTC2, NAP-2, NAP-2-L1, neutrophil-activating peptide 2, neutrophil-activating peptide-2, PBPTHBGB, platelet basic protein, pro-platelet basic protein (chemokine (C-X-C motif) ligand 7), SCAR10, SCYB7beta-thromboglobulin, small inducible cytokine B7, small inducible cytokine subfamily B, member 7, Small-inducible cytokine B7, TGB, TGB1B-TG1, THBGB1, thrombocidin 1, thrombocidin 2, thromboglobulin, beta-1 |
|---|
| Gene, Accession # | PPBP, Gene ID: 5473 |
|---|
| Catalog # | NBP1-89921 |
|---|
| Price | |
|---|
| Order / More Info | CXCL7/NAP-2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22093360 |
|---|
| 产品资料 |
|
|