| 产品详情 |
| Edit |   |
| Antigenic Specificity | VTA1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The VTA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VTA1. This antibody reacts with human, mouse, rat. The VTA1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat VTA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEA |
| Other Names | C6orf55DRG1, Dopamine-responsive gene 1 protein, DRG-1, FLJ27228, homolog of mouse SKD1-binding protein 1, LIP5HSPC228, LYST-interacting protein 5, My012, SBP1chromosome 6 open reading frame 55, SKD1-binding protein 1, vacuolar protein sorting-associated protein VTA1 homolog, Vps20-associated 1 homolog (S. cerevisiae) |
| Gene, Accession # | VTA1, Gene ID: 51534 |
| Catalog # | NBP1-86745 |
| Price | |
| Order / More Info | VTA1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|