| Edit |   |
|---|
| Antigenic Specificity | TRIM49 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRIM49 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRIM49. This antibody reacts with human. The TRIM49 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TRIM49 (tripartite motif-containing 49) The peptide sequence was selected from the middle region of TRIM49. Peptide sequence VHITLHHEEANNDIFLYEILRSMCIGCDHQDVPYFTATPRSFLAWGVQTF. |
|---|
| Other Names | RING finger protein 18TRIM49L2, RNF18testis-specific RING Finger protein, Testis-specific RING-finger protein, tripartite motif containing 49, tripartite motif-containing 49, tripartite motif-containing protein 49 |
|---|
| Gene, Accession # | TRIM49, Gene ID: 57093, Accession: Q9NS80, SwissProt: Q9NS80 |
|---|
| Catalog # | NBP1-55024 |
|---|
| Price | |
|---|
| Order / More Info | TRIM49 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|