| Edit |   |
| Antigenic Specificity | TRIM48 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TRIM48 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRIM48. This antibody reacts with human. The TRIM48 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human TRIM48The immunogen for this antibody is TRIM48. Peptide sequence NVETTRISHWKAFGDILYRSESVLLHMPQPLNLALRAGPITGLRDRLNQF. |
| Other Names | MGC4827, RING finger protein 101, RNF101tripartite motif-containing 48, tripartite motif containing 48, tripartite motif-containing protein 48 |
| Gene, Accession # | TRIM48, Gene ID: 79097, Accession: NP_077019, SwissProt: NP_077019 |
| Catalog # | NBP1-79458-20ul |
| Price | |
| Order / More Info | TRIM48 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |