| Edit |   |
| Antigenic Specificity | SREB3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SREB3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SREB3. This antibody reacts with human. The SREB3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:KPVQMVPAISQNWTFHGPGATGQAAANWIAGFGRGPMPPTLLGIRQNGHAASRRLLGMDEVKGEKQLGRMFY |
| Other Names | G protein coupled receptor 173, G protein-coupled receptor 173, G-protein coupled receptor 173, probable G-protein coupled receptor 173, SREB3Super conserved receptor expressed in brain 3 |
| Gene, Accession # | GPR173, Gene ID: 54328 |
| Catalog # | NBP1-87002 |
| Price | |
| Order / More Info | SREB3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |