| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SRCRB4D |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SRCRB4D Antibody from Novus Biologicals is a rabbit polyclonal antibody to SRCRB4D. This antibody reacts with human. The SRCRB4D Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SRCRB4D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PGEAHFGPGRGPILLDNVKCRGEESALLLCSHIRWDAHNCDHSEDASVLCQP |
|---|
| Other Names | S4D-SRCRB, S4-SRCRB, scavenger receptor cysteine rich domain containing, group B (4 domains), scavenger receptor cysteine-rich domain-containing group B protein, scavenger receptor cysteine-rich protein SRCRB-S4D, SRCRB-S4D, SSC4D |
|---|
| Gene, Accession # | SRCRB4D, Gene ID: 136853, Accession: Q8WTU2, SwissProt: Q8WTU2 |
|---|
| Catalog # | NBP2-37994 |
|---|
| Price | |
|---|
| Order / More Info | SRCRB4D Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|