| Edit |   |
| Antigenic Specificity | Plxdc2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Plxdc2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Plxdc2. This antibody reacts with mouse. The Plxdc2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is Plxdc2. Peptide sequence HLKDSGASTDDSAAEKKGGTLHAGLIVGILILVLIIAAAILVTVYMYHHP. |
| Other Names | plexin domain containing 2,1200007L24Rik, plexin domain-containing protein 2, TEM7RFLJ14623, Tumor endothelial marker 7-related protein |
| Gene, Accession # | PLXDC2, Gene ID: 84898, Accession: NP_080438 |
| Catalog # | NBP1-79337 |
| Price | |
| Order / More Info | Plxdc2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |