| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PLUNC |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PLUNC Antibody from Novus Biologicals is a rabbit polyclonal antibody to PLUNC. This antibody reacts with human. The PLUNC Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to PLUNC(palate, lung and nasal epithelium carcinoma associated) The peptide sequence was selected from the middle region of PLUNC (NP_057667). Peptide sequence GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASL. |
|---|
| Other Names | bA49G10.5, ligand-binding protein RYA3, LPLUNC3, Lung-specific protein X, LUNXNASG, Nasopharyngeal carcinoma-related protein, Palate lung and nasal epithelium clone protein, palate, lung and nasal epithelium associated, palate, lung and nasal epithelium carcinoma associated, protein Plunc, Secretory protein in upper respiratory tracts, SPLUNC1SPURT, tracheal epithelium enriched protein, Tracheal epithelium-enriched protein, Von Ebner protein Hl |
|---|
| Gene, Accession # | BPIFA1, Gene ID: 51297, Accession: Q9NP55, SwissProt: Q9NP55 |
|---|
| Catalog # | NBP1-58979 |
|---|
| Price | |
|---|
| Order / More Info | PLUNC Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|