| 产品详情 |
| Edit |   |
| Antigenic Specificity | RPP30 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RPP30 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPP30. This antibody reacts with human. The RPP30 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RPP30 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGETRKTAFGIISTVKKPRPSEGDEDCLPASKKAKCEG |
| Other Names | EC 3.1.26.5, FLJ38491, ribonuclease P (30kD) (RPP30), ribonuclease P protein subunit p30, ribonuclease P/MRP 30kDa subunit, RNase P subunit 2, RNaseP protein p30, RNASEP2, TSG15 |
| Gene, Accession # | RPP30, Gene ID: 10556, Accession: P78346 |
| Catalog # | NBP1-80658 |
| Price | |
| Order / More Info | RPP30 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|