| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RPP14 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RPP14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPP14. This antibody reacts with human. The RPP14 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RPP14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAILRICSSGLVK |
|---|
| Other Names | EC 3.1.26.5, EC 4.2.1.-, FLJ31508, HsHTD2, P14,3-hydroxyacyl-[acyl-carrier-protein] dehydratase, ribonuclease P (14kD), ribonuclease P 14kDa subunit, ribonuclease P protein subunit p14, ribonuclease P/MRP 14kDa subunit |
|---|
| Gene, Accession # | RPP14, Gene ID: 11102 |
|---|
| Catalog # | NBP1-80965 |
|---|
| Price | |
|---|
| Order / More Info | RPP14 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|