| 产品详情 |
| Edit |   |
| Antigenic Specificity | MRPS26 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MRPS26 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MRPS26. This antibody reacts with human. The MRPS26 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MRPS26 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EVLQLQEEVKNFITRENLEARVEAALDSRKNYNWAITREGLVVRPQRRDS |
| Other Names | C20orf193, dJ534B8.3, GI008,28S ribosomal protein S13, mitochondrial, mitochondrial ribosomal protein S26, MRP-S13MRPS13, MRP-S26chromosome 20 open reading frame 193, NY-BR-87, RPMS1328S ribosomal protein S26, mitochondrial, S13mt, S26mt, serologically defined breast cancer antigen NY-BR-87 |
| Gene, Accession # | MRPS26, Gene ID: 64949 |
| Catalog # | NBP1-92141 |
| Price | |
| Order / More Info | MRPS26 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|