| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CSAD |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CSAD Antibody from Novus Biologicals is a rabbit polyclonal antibody to CSAD. This antibody reacts with human. The CSAD Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CSAD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FGVVVDEAIQKGTSVSQKVCEWKEPEELKQLLDLELRSQGESQKQILERCRAVIRYSVK |
|---|
| Other Names | CSDMGC119355, cysteine sulfinic acid decarboxylase, Cysteine-sulfinate decarboxylase, EC 4.1.1, EC 4.1.1.29, FLJ44987, FLJ45500, MGC119354, MGC119357, PCAP, P-selectin cytoplasmic tail-associated protein, Sulfinoalanine decarboxylase |
|---|
| Gene, Accession # | CSAD, Gene ID: 51380 |
|---|
| Catalog # | NBP1-84373 |
|---|
| Price | |
|---|
| Order / More Info | CSAD Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|