| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MRPS2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MRPS2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MRPS2. This antibody reacts with human. The MRPS2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MRPS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IFEPHVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGAD |
|---|
| Other Names | 28S ribosomal protein S2, mitochondrial, CGI-91, mitochondrial 28S ribosomal protein S2, mitochondrial ribosomal protein S2, MRP-S2, S2mt |
|---|
| Gene, Accession # | MRPS2, Gene ID: 51116, Accession: Q9Y399, SwissProt: Q9Y399 |
|---|
| Catalog # | NBP2-33822 |
|---|
| Price | |
|---|
| Order / More Info | MRPS2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|