| Edit |   |
|---|
| Antigenic Specificity | CATSPERG |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CATSPERG Antibody from Novus Biologicals is a rabbit polyclonal antibody to CATSPERG. This antibody reacts with human. The CATSPERG Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human C19orf15. Peptide sequence FFLIQDLVTGDSGSFQGSYVLLVVGGGPTLDSLKDYSEDEIYRFNSPLDK. |
|---|
| Other Names | cation channel, sperm-associated, gamma, FLJ38899 |
|---|
| Gene, Accession # | CATSPERG, Gene ID: 57828, Accession: NP_067008, SwissProt: NP_067008 |
|---|
| Catalog # | NBP1-91342-20ul |
|---|
| Price | |
|---|
| Order / More Info | CATSPERG Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|